Lineage for d5cksd_ (5cks D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835534Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)
  6. 2835733Protein automated matches [190083] (10 species)
    not a true protein
  7. 2835764Species Escherichia coli [TaxId:83333] [320941] (2 PDB entries)
  8. 2835768Domain d5cksd_: 5cks D: [320984]
    automated match to d1og0h_
    complexed with 52l, gal

Details for d5cksd_

PDB Entry: 5cks (more details), 2.12 Å

PDB Description: dahp (3-deoxy-d-arabinoheptulosonate-7-phosphate) synthase in complex with dahp oxime.
PDB Compounds: (D:) Phospho-2-dehydro-3-deoxyheptonate aldolase, Phe-sensitive

SCOPe Domain Sequences for d5cksd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cksd_ c.1.10.4 (D:) automated matches {Escherichia coli [TaxId: 83333]}
ddlrikeikellppvallekfpatenaantvaharkaihkilkgnddrllvvigpcsihd
pvaakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglri
arkllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgf
kngtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakh
vaevkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshl
vegnqslesgeplaygksitdacigwedtdallrqlanavkarrg

SCOPe Domain Coordinates for d5cksd_:

Click to download the PDB-style file with coordinates for d5cksd_.
(The format of our PDB-style files is described here.)

Timeline for d5cksd_: