Lineage for d5ccza_ (5ccz A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2424043Superfamily c.1.13: Malate synthase G [51645] (1 family) (S)
  5. 2424044Family c.1.13.1: Malate synthase G [51646] (2 protein domains)
  6. 2424045Protein Malate synthase G [51647] (3 species)
    contains the insert of all-beta (sub)domain and the C-terminal extension of all-alpha (sub)domain
  7. 2424058Species Mycobacterium tuberculosis [TaxId:83332] [324391] (26 PDB entries)
  8. 2424076Domain d5ccza_: 5ccz A: [320980]
    automated match to d2jqxa_
    complexed with 50c, mg

Details for d5ccza_

PDB Entry: 5ccz (more details), 2.14 Å

PDB Description: crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-(4-fluorophenyl)-4-methyl-1h-pyrazol-5-amine
PDB Compounds: (A:) malate synthase g

SCOPe Domain Sequences for d5ccza_:

Sequence, based on SEQRES records: (download)

>d5ccza_ c.1.13.1 (A:) Malate synthase G {Mycobacterium tuberculosis [TaxId: 83332]}
tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
aqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpv
lnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvp
lssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhiei
lidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaa
avdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfeg
imdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlg
lpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkg
tmksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastaw
vpsptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnn
cqsilgyvvrwvdqgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvras
lermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrref
karaae

Sequence, based on observed residues (ATOM records): (download)

>d5ccza_ c.1.13.1 (A:) Malate synthase G {Mycobacterium tuberculosis [TaxId: 83332]}
tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
aqidkwhrrrpidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpvlna
rfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvplss
gsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhieilid
pesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaarvl
nrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegimdalftgliaih
glkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpqntmkigimde
errttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmksqpwilayed
hnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpsptaatlhalh
yhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnncqsilgyvvrwvd
qgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvraslermaplvdrqna
gdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefkaraae

SCOPe Domain Coordinates for d5ccza_:

Click to download the PDB-style file with coordinates for d5ccza_.
(The format of our PDB-style files is described here.)

Timeline for d5ccza_: