Lineage for d5cvtb_ (5cvt B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439847Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2439848Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 protein domains)
    automatically mapped to Pfam PF00731
  6. 2439898Protein automated matches [191111] (3 species)
    not a true protein
  7. 2439899Species Acetobacter aceti [TaxId:1457393] [311949] (18 PDB entries)
  8. 2439913Domain d5cvtb_: 5cvt B: [320978]
    automated match to d4ycbb_
    complexed with act, cit, k, pgf; mutant

Details for d5cvtb_

PDB Entry: 5cvt (more details), 1.78 Å

PDB Description: structure of a single tryptophan mutant of acetobacter aceti pure containing 5-fluorotryptophan, ph 5.4
PDB Compounds: (B:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d5cvtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cvtb_ c.23.8.1 (B:) automated matches {Acetobacter aceti [TaxId: 1457393]}
sapvvgiimgsqsdfetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
aknaallaasilalynpalaarletfralqtasvpnspited

SCOPe Domain Coordinates for d5cvtb_:

Click to download the PDB-style file with coordinates for d5cvtb_.
(The format of our PDB-style files is described here.)

Timeline for d5cvtb_: