Lineage for d5da5m_ (5da5 M:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704883Species Rhodospirillum rubrum [TaxId:1085] [320959] (5 PDB entries)
  8. 2704922Domain d5da5m_: 5da5 M: [320973]
    Other proteins in same PDB: d5da5a2, d5da5b2, d5da5d2, d5da5f2, d5da5g2, d5da5h2, d5da5i2, d5da5j2, d5da5k2, d5da5l2, d5da5n2, d5da5p2, d5da5t2, d5da5u2
    automated match to d1zpyg_
    complexed with ca, fe, goa

Details for d5da5m_

PDB Entry: 5da5 (more details), 2.06 Å

PDB Description: crystal structure of rhodospirillum rubrum rru_a0973
PDB Compounds: (M:) Rru_A0973

SCOPe Domain Sequences for d5da5m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5da5m_ a.25.1.0 (M:) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
amtlewlrrndakwaehlrtylftegpita

SCOPe Domain Coordinates for d5da5m_:

Click to download the PDB-style file with coordinates for d5da5m_.
(The format of our PDB-style files is described here.)

Timeline for d5da5m_: