SCOP 1.67: Domain d1bh2_2: 1bh2 32-60,182-346

Lineage for d1bh2_2 (1bh2 32-60,182-346)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (37 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (2 species)
   common fold is interrupted with an all-alpha domain

7. Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (18 PDB entries)

8. Domain d1bh2_2: 1bh2 32-60,182-346 [32097]
   Other proteins in same PDB: d1bh2_1
   complexed with gsp, mg; mutant

Details for d1bh2_2

PDB Entry: 1bh2, 2.1 Å

PDB Description: a326s mutant of an inhibitory alpha subunit

SCOP Domain Sequences for d1bh2_2:

Sequence; same for both SEQRES and ATOM records:

>d1bh2_2 c.37.1.8 (32-60,182-346) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
revkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcstdtkn
vqfvfdavtdviikn

Timeline for d1bh2_2:

• d1bh2_2 first appeared (with stable ids) in SCOP 1.55
  
• d1bh2_2 appears in SCOP 1.65
  
• d1bh2_2 appears in SCOP 1.69
  
• d1bh2_2 appears in the current release, SCOPe 2.08, called d1bh2a2