Lineage for d5da5h1 (5da5 H:7-96)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314636Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2314637Protein automated matches [190036] (44 species)
    not a true protein
  7. 2315361Species Rhodospirillum rubrum [TaxId:1085] [320959] (4 PDB entries)
  8. 2315369Domain d5da5h1: 5da5 H:7-96 [320961]
    Other proteins in same PDB: d5da5a2, d5da5b2, d5da5d2, d5da5f2, d5da5g2, d5da5h2, d5da5i2, d5da5j2, d5da5k2, d5da5l2, d5da5n2, d5da5p2, d5da5t2, d5da5u2
    automated match to d1zpyg_
    complexed with ca, fe, goa

Details for d5da5h1

PDB Entry: 5da5 (more details), 2.06 Å

PDB Description: crystal structure of rhodospirillum rubrum rru_a0973
PDB Compounds: (H:) Rru_A0973

SCOPe Domain Sequences for d5da5h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5da5h1 a.25.1.0 (H:7-96) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeha
amtlewlrrndakwaehlrtylftegpita

SCOPe Domain Coordinates for d5da5h1:

Click to download the PDB-style file with coordinates for d5da5h1.
(The format of our PDB-style files is described here.)

Timeline for d5da5h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5da5h2