![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) ![]() |
![]() | Family c.37.1.8: G proteins [52592] (23 proteins) |
![]() | Protein Transducin (alpha subunit) [52623] (2 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (17 PDB entries) |
![]() | Domain d1gota2: 1got A:6-60,A:182-343 [32096] Other proteins in same PDB: d1gota1, d1gotb_, d1gotg_ |
PDB Entry: 1got (more details), 2 Å
SCOP Domain Sequences for d1gota2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gota2 c.37.1.8 (A:6-60,A:182-343) Transducin (alpha subunit) {Rat (Rattus norvegicus)} saeekhsrelekklkedaekdartvkllllgagesgkstivkqmkiihqdgysleXetqf sfkdlnfrmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmkl fdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeagnyikvqfle lnmrrdvkeiyshmtcatdtqnvkfvfdavtdiiiken
Timeline for d1gota2: