Lineage for d1gota2 (1got A:6-60,A:182-343)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23317Protein Transducin (alpha subunit) [52623] (2 species)
  7. 23335Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (17 PDB entries)
  8. 23340Domain d1gota2: 1got A:6-60,A:182-343 [32096]
    Other proteins in same PDB: d1gota1, d1gotb_, d1gotg_

Details for d1gota2

PDB Entry: 1got (more details), 2 Å

PDB Description: heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits

SCOP Domain Sequences for d1gota2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gota2 c.37.1.8 (A:6-60,A:182-343) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
saeekhsrelekklkedaekdartvkllllgagesgkstivkqmkiihqdgysleXetqf
sfkdlnfrmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmkl
fdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeagnyikvqfle
lnmrrdvkeiyshmtcatdtqnvkfvfdavtdiiiken

SCOP Domain Coordinates for d1gota2:

Click to download the PDB-style file with coordinates for d1gota2.
(The format of our PDB-style files is described here.)

Timeline for d1gota2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gota1