Lineage for d1gota2 (1got A:6-60,A:182-343)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867892Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 2867943Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries)
    Uniprot P10824
  8. 2867965Domain d1gota2: 1got A:6-60,A:182-343 [32096]
    Other proteins in same PDB: d1gota1, d1gotb_, d1gotg_
    species chimera
    complexed with gdp

    has additional subdomain(s) that are not in the common domain

Details for d1gota2

PDB Entry: 1got (more details), 2 Å

PDB Description: heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
PDB Compounds: (A:) gt-alpha/gi-alpha chimera

SCOPe Domain Sequences for d1gota2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gota2 c.37.1.8 (A:6-60,A:182-343) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
saeekhsrelekklkedaekdartvkllllgagesgkstivkqmkiihqdgysleXetqf
sfkdlnfrmfdvggqrserkkwihcfegvtaiifcvalsdydlvlaedeemnrmhesmkl
fdsicnnkwftdtsiilflnkkdlfeekikksplticypeyagsntyeeagnyikvqfle
lnmrrdvkeiyshmtcatdtqnvkfvfdavtdiiiken

SCOPe Domain Coordinates for d1gota2:

Click to download the PDB-style file with coordinates for d1gota2.
(The format of our PDB-style files is described here.)

Timeline for d1gota2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gota1