| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins) automatically mapped to Pfam PF02240 |
| Protein automated matches [320245] (3 species) not a true protein |
| Species Methanothermobacter marburgensis [TaxId:145263] [320932] (1 PDB entry) |
| Domain d5a8rl_: 5a8r L: [320936] automated match to d3m2vc_ complexed with com, f43, k, tp7 |
PDB Entry: 5a8r (more details), 2.15 Å
SCOPe Domain Sequences for d5a8rl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a8rl_ d.58.31.1 (L:) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
sykaqytpgetqiaenrrkhmdpdyefrklrevsdedlvkvlghrnpgesyksvhpplde
mdfeedivrdmvepiqgakegvrvryiqfadsmynapaqpydrartymwryrgvdtgtls
grqviemreldlegvskelvetelfdpattgirgatvhghslrldenglmfdalqryvfd
eekghvvyvkdqvgrpldepvdmgqplgedelkkittiyrkdniamrddkeaievvenih
tgrtlggfgmdvfkddlrkrlgd
Timeline for d5a8rl_: