Lineage for d5a8rl_ (5a8r L:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955026Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2955027Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins)
    automatically mapped to Pfam PF02240
  6. 2955066Protein automated matches [320245] (3 species)
    not a true protein
  7. 2955067Species Methanothermobacter marburgensis [TaxId:145263] [320932] (1 PDB entry)
  8. 2955071Domain d5a8rl_: 5a8r L: [320936]
    automated match to d3m2vc_
    complexed with com, f43, k, tp7

Details for d5a8rl_

PDB Entry: 5a8r (more details), 2.15 Å

PDB Description: methyl-coenzyme m reductase ii from methanothermobacter marburgensis at 2.15 a resolution
PDB Compounds: (L:) methyl-coenzyme m reductase II, subunit beta

SCOPe Domain Sequences for d5a8rl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a8rl_ d.58.31.1 (L:) automated matches {Methanothermobacter marburgensis [TaxId: 145263]}
sykaqytpgetqiaenrrkhmdpdyefrklrevsdedlvkvlghrnpgesyksvhpplde
mdfeedivrdmvepiqgakegvrvryiqfadsmynapaqpydrartymwryrgvdtgtls
grqviemreldlegvskelvetelfdpattgirgatvhghslrldenglmfdalqryvfd
eekghvvyvkdqvgrpldepvdmgqplgedelkkittiyrkdniamrddkeaievvenih
tgrtlggfgmdvfkddlrkrlgd

SCOPe Domain Coordinates for d5a8rl_:

Click to download the PDB-style file with coordinates for d5a8rl_.
(The format of our PDB-style files is described here.)

Timeline for d5a8rl_: