![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
![]() | Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins) automatically mapped to Pfam PF02240 |
![]() | Protein automated matches [320245] (3 species) not a true protein |
![]() | Species Methanothermobacter marburgensis [TaxId:145263] [320932] (1 PDB entry) |
![]() | Domain d5a8rf_: 5a8r F: [320933] automated match to d3m2vc_ complexed with com, f43, k, tp7 |
PDB Entry: 5a8r (more details), 2.15 Å
SCOPe Domain Sequences for d5a8rf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a8rf_ d.58.31.1 (F:) automated matches {Methanothermobacter marburgensis [TaxId: 145263]} ykaqytpgetqiaenrrkhmdpdyefrklrevsdedlvkvlghrnpgesyksvhppldem dfeedivrdmvepiqgakegvrvryiqfadsmynapaqpydrartymwryrgvdtgtlsg rqviemreldlegvskelvetelfdpattgirgatvhghslrldenglmfdalqryvfde ekghvvyvkdqvgrpldepvdmgqplgedelkkittiyrkdniamrddkeaievveniht grtlggfgmdvfkddlrkrlg
Timeline for d5a8rf_: