Lineage for d1cipa2 (1cip A:32-60,A:182-347)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein Transducin (alpha subunit) [52623] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [52625] (17 PDB entries) 
Domain d1cipa2: 1cip A:32-60,A:182-347 [32093]
Other proteins in same PDB: d1cipa1
Details for d1cipa2
PDB Entry: 1cip (more details), 1.5 Å
PDB Description: gi-alpha-1 subunit of guanine nucleotide-binding protein complexed with a gtp analogue
SCOP Domain Sequences for d1cipa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cipa2 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus)}
revkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
vqfvfdavtdviiknn
SCOP Domain Coordinates for d1cipa2:
Click to download the PDB-style file with coordinates for d1cipa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cipa2:
- d1cipa2 appears in SCOP 1.57
- d1cipa2 appears in the current release, SCOPe 2.08
View in 3D
