| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [52625] (21 PDB entries) Uniprot P10824 |
| Domain d1cipa2: 1cip A:32-60,A:182-347 [32093] Other proteins in same PDB: d1cipa1 complexed with gnp, mg has additional subdomain(s) that are not in the common domain |
PDB Entry: 1cip (more details), 1.5 Å
SCOPe Domain Sequences for d1cipa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cipa2 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
revkllllgagesgkstivkqmkiiheagXtgivethftfkdlhfkmfdvggqrserkkw
ihcfegvtaiifcvalsdydlvlaedeemnrmhesmklfdsicnnkwftdtsiilflnkk
dlfeekikksplticypeyagsntyeeaaayiqcqfedlnkrkdtkeiythftcatdtkn
vqfvfdavtdviiknn
Timeline for d1cipa2: