Lineage for d5kswc_ (5ksw C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414849Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2414850Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2415254Protein automated matches [190228] (19 species)
    not a true protein
  7. 2415278Species Lactococcus lactis [TaxId:1358] [186992] (3 PDB entries)
  8. 2415284Domain d5kswc_: 5ksw C: [320925]
    Other proteins in same PDB: d5kswb1, d5kswb2, d5kswd1, d5kswd2
    automated match to d1ep3a_
    complexed with cl, edo, fad, fes, fmn; mutant

Details for d5kswc_

PDB Entry: 5ksw (more details), 2.47 Å

PDB Description: dhodb-i74d mutant
PDB Compounds: (C:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d5kswc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kswc_ c.1.4.1 (C:) automated matches {Lactococcus lactis [TaxId: 1358]}
nrlsvklpgldlknpiipasgcfgfgeeyakyydlnklgsimvkattlhprfgnptprva
etasgmlnadglqnpglevimaeklpwlnenfpdlpiianvagseeddyvavcakigdap
nvkvielniscpnvkhggqafgtdpdvaaalvkackavskvplyvklspnvtdivpiaka
veaagadgltmintlmgvrfdlktrkpvlanitgglsgpaikpvalklihqvaqvvdipi
igmggvesaqdvlemymagasavavgtanfadpfvcpkiieklpevmdqygidslenliq
evkns

SCOPe Domain Coordinates for d5kswc_:

Click to download the PDB-style file with coordinates for d5kswc_.
(The format of our PDB-style files is described here.)

Timeline for d5kswc_: