SCOPe 2.07: Domain d1cjuc2: 1cju C:39-66,C:202-388

Lineage for d1cjuc2 (1cju C:39-66,C:202-388)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries)
   Uniprot P04896 39-388

8. Domain d1cjuc2: 1cju C:39-66,C:202-388 [32090]
   Other proteins in same PDB: d1cjua_, d1cjub_, d1cjuc1
   complexed with cl, dad, fok, gsp, mg

Details for d1cjuc2

PDB Entry: 1cju, 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp and mg

PDB Compounds: (C:) guanine nucleotide-binding protein g(s)

SCOPe Domain Sequences for d1cjuc2:

Sequence; same for both SEQRES and ATOM records:

>d1cjuc2 c.37.1.8 (C:39-66,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
athrllllgagesgkstivkqmrilhvnXvltsgifetkfqvdkvnfhmfdvggqrderr
kwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilfln
kqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristas
gdgrhycyphftcavdtenirrvfndcrdiiqrmhl

Timeline for d1cjuc2:

• d1cjuc2 first appeared (with stable ids) in SCOP 1.55
  
• d1cjuc2 appears in SCOPe 2.06
  
• d1cjuc2 appears in the current release, SCOPe 2.08