Lineage for d1cjuc2 (1cju C:39-66,C:202-388)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582325Protein Transducin (alpha subunit) [52623] (2 species)
    common fold is interrupted with an all-alpha domain
  7. 582326Species Cow (Bos taurus) [TaxId:9913] [52624] (13 PDB entries)
  8. 582340Domain d1cjuc2: 1cju C:39-66,C:202-388 [32090]
    Other proteins in same PDB: d1cjua_, d1cjub_, d1cjuc1
    complexed with cl, dad, fok, gsp, mg; mutant

Details for d1cjuc2

PDB Entry: 1cju (more details), 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp and mg

SCOP Domain Sequences for d1cjuc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjuc2 c.37.1.8 (C:39-66,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus)}
athrllllgagesgkstivkqmrilhvnXvltsgifetkfqvdkvnfhmfdvggqrderr
kwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilfln
kqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristas
gdgrhycyphftcavdtenirrvfndcrdiiqrmhl

SCOP Domain Coordinates for d1cjuc2:

Click to download the PDB-style file with coordinates for d1cjuc2.
(The format of our PDB-style files is described here.)

Timeline for d1cjuc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cjuc1