SCOP 1.75: Domain d1cjtc2: 1cjt C:39-65,C:202-388

Lineage for d1cjtc2 (1cjt C:39-65,C:202-388)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (15 PDB entries)
   Uniprot P04896 39-388

8. Domain d1cjtc2: 1cjt C:39-65,C:202-388 [32089]
   Other proteins in same PDB: d1cjta_, d1cjtb_, d1cjtc1
   complexed with cl, dad, fok, gsp, mes, mg, mn; mutant

Details for d1cjtc2

PDB Entry: 1cjt, 2.8 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase: complex with beta-l-2',3'-dideoxyatp, mn, and mg

PDB Compounds: (C:) guanine nucleotide-binding protein g(s)

SCOP Domain Sequences for d1cjtc2:

Sequence; same for both SEQRES and ATOM records:

>d1cjtc2 c.37.1.8 (C:39-65,C:202-388) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
athrllllgagesgkstivkqmrilhvXvltsgifetkfqvdkvnfhmfdvggqrderrk
wiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvilflnk
qdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflristasg
dgrhycyphftcavdtenirrvfndcrdiiqrmhl

Timeline for d1cjtc2:

• d1cjtc2 first appeared (with stable ids) in SCOP 1.55
  
• d1cjtc2 appears in SCOP 1.73
  
• d1cjtc2 appears in SCOPe 2.01
  
• d1cjtc2 appears in the current release, SCOPe 2.08