SCOP 1.75: Domain d1azsc2: 1azs C:36-66,C:202-393

Lineage for d1azsc2 (1azs C:36-66,C:202-393)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Transducin (alpha subunit) [52623] (4 species)
   common fold is interrupted with an all-alpha domain

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (15 PDB entries)
   Uniprot P04896 39-388

8. Domain d1azsc2: 1azs C:36-66,C:202-393 [32086]
   Other proteins in same PDB: d1azsa_, d1azsb_, d1azsc1
   complexed with fkp, gsp, mg; mutant

Details for d1azsc2

PDB Entry: 1azs, 2.3 Å

PDB Description: complex of gs-alpha with the catalytic domains of mammalian adenylyl cyclase

PDB Compounds: (C:) gs-alpha

SCOP Domain Sequences for d1azsc2:

Sequence; same for both SEQRES and ATOM records:

>d1azsc2 c.37.1.8 (C:36-66,C:202-393) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
vyrathrllllgagesgkstivkqmrilhvnXvltsgifetkfqvdkvnfhmfdvggqrd
errkwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvil
flnkqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflris
tasgdgrhycyphftcavdtenirrvfndcrdiiqrmhlrqyel

Timeline for d1azsc2:

• d1azsc2 first appeared (with stable ids) in SCOP 1.55
  
• d1azsc2 appears in SCOP 1.73
  
• d1azsc2 appears in SCOPe 2.01
  
• d1azsc2 appears in the current release, SCOPe 2.08