Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (35 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Transducin (alpha subunit) [52623] (2 species) common fold is interrupted with an all-alpha domain |
Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries) |
Domain d1azsc2: 1azs C:36-66,C:202-393 [32086] Other proteins in same PDB: d1azsa_, d1azsb_, d1azsc1 complexed with fkp, gsp, mg; mutant |
PDB Entry: 1azs (more details), 2.3 Å
SCOP Domain Sequences for d1azsc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azsc2 c.37.1.8 (C:36-66,C:202-393) Transducin (alpha subunit) {Cow (Bos taurus)} vyrathrllllgagesgkstivkqmrilhvnXvltsgifetkfqvdkvnfhmfdvggqrd errkwiqcfndvtaiifvvasssynmvirednqtnrlqealnlfksiwnnrwlrtisvil flnkqdllaekvlagkskiedyfpefaryttpedatpepgedprvtrakyfirdeflris tasgdgrhycyphftcavdtenirrvfndcrdiiqrmhlrqyel
Timeline for d1azsc2: