Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (78 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Transducin (alpha subunit) [52623] (3 species) common fold is interrupted with an all-alpha domain |
Species Cow (Bos taurus) [TaxId:9913] [52624] (15 PDB entries) |
Domain d1tndc2: 1tnd C:27-56,C:178-342 [32083] Other proteins in same PDB: d1tnda1, d1tndb1, d1tndc1 complexed with cac, gsp, mg |
PDB Entry: 1tnd (more details), 2.2 Å
SCOP Domain Sequences for d1tndc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tndc2 c.37.1.8 (C:27-56,C:178-342) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq nvkfvfdavtdiiike
Timeline for d1tndc2:
View in 3D Domains from other chains: (mouse over for more information) d1tnda1, d1tnda2, d1tndb1, d1tndb2 |