Lineage for d1tndb2 (1tnd B:27-56,B:178-342)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313510Family c.37.1.8: G proteins [52592] (35 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 313840Protein Transducin (alpha subunit) [52623] (2 species)
    common fold is interrupted with an all-alpha domain
  7. 313841Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)
  8. 313847Domain d1tndb2: 1tnd B:27-56,B:178-342 [32082]
    Other proteins in same PDB: d1tnda1, d1tndb1, d1tndc1

Details for d1tndb2

PDB Entry: 1tnd (more details), 2.2 Å

PDB Description: the 2.2 angstroms crystal structure of transducin-alpha complexed with gtp gamma s

SCOP Domain Sequences for d1tndb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tndb2 c.37.1.8 (B:27-56,B:178-342) Transducin (alpha subunit) {Cow (Bos taurus)}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiiike

SCOP Domain Coordinates for d1tndb2:

Click to download the PDB-style file with coordinates for d1tndb2.
(The format of our PDB-style files is described here.)

Timeline for d1tndb2: