Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (35 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Transducin (alpha subunit) [52623] (2 species) common fold is interrupted with an all-alpha domain |
Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries) |
Domain d1tndb2: 1tnd B:27-56,B:178-342 [32082] Other proteins in same PDB: d1tnda1, d1tndb1, d1tndc1 |
PDB Entry: 1tnd (more details), 2.2 Å
SCOP Domain Sequences for d1tndb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tndb2 c.37.1.8 (B:27-56,B:178-342) Transducin (alpha subunit) {Cow (Bos taurus)} artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq nvkfvfdavtdiiike
Timeline for d1tndb2:
View in 3D Domains from other chains: (mouse over for more information) d1tnda1, d1tnda2, d1tndc1, d1tndc2 |