Lineage for d1tnda2 (1tnd A:27-56,A:178-349)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846866Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 1846867Species Cow (Bos taurus) [TaxId:9913] [52624] (18 PDB entries)
    Uniprot P04896 39-388
  8. 1846872Domain d1tnda2: 1tnd A:27-56,A:178-349 [32081]
    Other proteins in same PDB: d1tnda1, d1tndb1, d1tndc1
    complexed with cac, gsp, mg

Details for d1tnda2

PDB Entry: 1tnd (more details), 2.2 Å

PDB Description: the 2.2 angstroms crystal structure of transducin-alpha complexed with gtp gamma s
PDB Compounds: (A:) transducin

SCOPe Domain Sequences for d1tnda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnda2 c.37.1.8 (A:27-56,A:178-349) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiiikenlkdcgl

SCOPe Domain Coordinates for d1tnda2:

Click to download the PDB-style file with coordinates for d1tnda2.
(The format of our PDB-style files is described here.)

Timeline for d1tnda2: