Lineage for d1tag_2 (1tag 27-56,178-340)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 122147Protein Transducin (alpha subunit) [52623] (2 species)
  7. 122148Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)
  8. 122152Domain d1tag_2: 1tag 27-56,178-340 [32080]
    Other proteins in same PDB: d1tag_1

Details for d1tag_2

PDB Entry: 1tag (more details), 1.8 Å

PDB Description: structural determinants for activation of the alpha-subunit of a heterotrimeric g protein

SCOP Domain Sequences for d1tag_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tag_2 c.37.1.8 (27-56,178-340) Transducin (alpha subunit) {Cow (Bos taurus)}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiii

SCOP Domain Coordinates for d1tag_2:

Click to download the PDB-style file with coordinates for d1tag_2.
(The format of our PDB-style files is described here.)

Timeline for d1tag_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tag_1