Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (31 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Transducin (alpha subunit) [52623] (2 species) common fold is interrupted with an all-alpha domain |
Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries) |
Domain d1tadc2: 1tad C:27-56,C:178-344 [32079] Other proteins in same PDB: d1tada1, d1tadb1, d1tadc1 complexed with alf, ca, cac, gdp |
PDB Entry: 1tad (more details), 1.7 Å
SCOP Domain Sequences for d1tadc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tadc2 c.37.1.8 (C:27-56,C:178-344) Transducin (alpha subunit) {Cow (Bos taurus)} artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq nvkfvfdavtdiiikenl
Timeline for d1tadc2:
View in 3D Domains from other chains: (mouse over for more information) d1tada1, d1tada2, d1tadb1, d1tadb2 |