SCOP 1.57: Domain d1tadb2: 1tad B:27-56,B:178-342

Lineage for d1tadb2 (1tad B:27-56,B:178-342)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families)

5. Family c.37.1.8: G proteins [52592] (20 proteins)

6. Protein Transducin (alpha subunit) [52623] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52624] (11 PDB entries)

8. Domain d1tadb2: 1tad B:27-56,B:178-342 [32078]
   Other proteins in same PDB: d1tada1, d1tadb1, d1tadc1

Details for d1tadb2

PDB Entry: 1tad, 1.7 Å

PDB Description: gtpase mechanism of gproteins from the 1.7-angstrom crystal structure of transducin alpha-gdp-alf4-

SCOP Domain Sequences for d1tadb2:

Sequence; same for both SEQRES and ATOM records:

>d1tadb2 c.37.1.8 (B:27-56,B:178-342) Transducin (alpha subunit) {Cow (Bos taurus)}
artvkllllgagesgkstivkqmkiihqdgXtgiietqfsfkdlnfrmfdvggqrserkk
wihcfegvtciifiaalsaydmvlveddevnrmheslhlfnsicnhryfattsivlflnk
kdvfsekikkahlsicfpdyngpntyedagnyikvqflelnmrrdvkeiyshmtcatdtq
nvkfvfdavtdiiike

Timeline for d1tadb2:

• d1tadb2 first appeared (with stable ids) in SCOP 1.55
  
• d1tadb2 appears in SCOP 1.59
  
• d1tadb2 appears in the current release, SCOPe 2.08