Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Ypt51 [52621] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52622] (1 PDB entry) |
Domain d1ek0a_: 1ek0 A: [32076] complexed with gdp, gnp, mg, ni |
PDB Entry: 1ek0 (more details), 1.48 Å
SCOPe Domain Sequences for d1ek0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} vtsiklvllgeaavgkssivlrfvsndfaenkeptigaafltqrvtinehtvkfeiwdta gqerfaslapmyyrnaqaalvvydvtkpqsfikarhwvkelheqaskdiiialvgnkidm lqeggerkvareegeklaeekgllffetsaktgenvndvflgigekiplk
Timeline for d1ek0a_: