Lineage for d1ek0a_ (1ek0 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595367Protein Ypt51 [52621] (1 species)
  7. 1595368Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52622] (1 PDB entry)
  8. 1595369Domain d1ek0a_: 1ek0 A: [32076]
    complexed with gdp, gnp, mg, ni

Details for d1ek0a_

PDB Entry: 1ek0 (more details), 1.48 Å

PDB Description: gppnhp-bound ypt51 at 1.48 a resolution
PDB Compounds: (A:) protein (GTP-binding protein ypt51)

SCOPe Domain Sequences for d1ek0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vtsiklvllgeaavgkssivlrfvsndfaenkeptigaafltqrvtinehtvkfeiwdta
gqerfaslapmyyrnaqaalvvydvtkpqsfikarhwvkelheqaskdiiialvgnkidm
lqeggerkvareegeklaeekgllffetsaktgenvndvflgigekiplk

SCOPe Domain Coordinates for d1ek0a_:

Click to download the PDB-style file with coordinates for d1ek0a_.
(The format of our PDB-style files is described here.)

Timeline for d1ek0a_: