Lineage for d1ek0a_ (1ek0 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein Ypt51 [52621] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52622] (1 PDB entry) 
Domain d1ek0a_: 1ek0 A: [32076]
Details for d1ek0a_
PDB Entry: 1ek0 (more details), 1.48 Å
PDB Description: gppnhp-bound ypt51 at 1.48 a resolution
SCOP Domain Sequences for d1ek0a_:
Sequence, based on SEQRES records: (download)
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae)}
vtsiklvllgeaavgkssivlrfvsndfaenkeptigaafltqrvtinehtvkfeiwdta
gqerfaslapxyyrnaqaalvvydvtkpqsfikarhwvkelheqaskdiiialvgnkidx
lqeggerkvareegeklaeekgllffetsaktgenvndvflgigekiplk
Sequence, based on observed residues (ATOM records): (download)
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae)}
vtsiklvllgeaavgkssivlrfvsndfaenkeptigaafltqrvtinehtvkfeiwdta
gqerfaslapyyrnaqaalvvydvtkpqsfikarhwvkelheqaskdiiialvgnkidlq
eggerkvareegeklaeekgllffetsaktgenvndvflgigekiplk
SCOP Domain Coordinates for d1ek0a_:
Click to download the PDB-style file with coordinates for d1ek0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ek0a_:
- d1ek0a_ appears in SCOP 1.57
- d1ek0a_ appears in the current release, SCOPe 2.08
View in 3D