Lineage for d1e0aa_ (1e0a A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124284Protein CDC42 [52619] (2 species)
  7. 2124285Species Human (Homo sapiens) [TaxId:9606] [52620] (30 PDB entries)
  8. 2124325Domain d1e0aa_: 1e0a A: [32074]
    Other proteins in same PDB: d1e0ab1, d1e0ab2
    complexed with gnp, mg

Details for d1e0aa_

PDB Entry: 1e0a (more details)

PDB Description: cdc42 complexed with the gtpase binding domain of p21 activated kinase
PDB Compounds: (A:) g25k GTP-binding protein, placental isoform (gp), cdc42 homolog

SCOPe Domain Sequences for d1e0aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e0aa_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
ledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkk

SCOPe Domain Coordinates for d1e0aa_:

Click to download the PDB-style file with coordinates for d1e0aa_.
(The format of our PDB-style files is described here.)

Timeline for d1e0aa_: