SCOPe 2.06: Domain d5kswd1: 5ksw D:1-102

Lineage for d5kswd1 (5ksw D:1-102)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.0: automated matches [227162] (1 protein)
   not a true family

6. Protein automated matches [226870] (20 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:1360] [320608] (2 PDB entries)

8. Domain d5kswd1: 5ksw D:1-102 [320717]
   Other proteins in same PDB: d5kswa_, d5kswb2, d5kswc_, d5kswd2
   automated match to d1ep3b1
   complexed with cl, edo, fad, fes, fmn; mutant

Details for d5kswd1

PDB Entry: 5ksw, 2.47 Å

PDB Description: dhodb-i74d mutant

PDB Compounds: (D:) Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit

SCOPe Domain Sequences for d5kswd1:

Sequence; same for both SEQRES and ATOM records:

>d5kswd1 b.43.4.0 (D:1-102) automated matches {Lactococcus lactis [TaxId: 1360]}
mpklqemmtivsqrevasnifemvlkgelveemdlpgqflhlavpnasmllrrpisissw
dkvaktctilyrigdetsgtyeisklqsgakidvmgplgngf

Timeline for d5kswd1:

• d5kswd1 is new in SCOPe 2.06-stable
  
• d5kswd1 appears in SCOPe 2.07
  
• d5kswd1 appears in the current release, SCOPe 2.08