Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein CDC42 [52619] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [52620] (33 PDB entries) |
Domain d1ajea_: 1aje A: [32071] |
PDB Entry: 1aje (more details)
SCOPe Domain Sequences for d1ajea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ajea_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} gskiisamqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytl glfdtagqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllv gtqidlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeai laaleppepkksrr
Timeline for d1ajea_: