SCOP 1.63: Domain d1aje__: 1aje -

Lineage for d1aje__ (1aje -)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (31 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (15 PDB entries)

8. Domain d1aje__: 1aje - [32071]

Details for d1aje__

PDB Entry: 1aje

PDB Description: cdc42 from human, nmr, 20 structures

SCOP Domain Sequences for d1aje__:

Sequence; same for both SEQRES and ATOM records:

>d1aje__ c.37.1.8 (-) CDC42 {Human (Homo sapiens)}
gskiisamqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytl
glfdtagqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllv
gtqidlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeai
laaleppepkksrr

Timeline for d1aje__:

• d1aje__ first appeared (with stable ids) in SCOP 1.55
  
• d1aje__ appears in SCOP 1.61
  
• d1aje__ appears in SCOP 1.65
  
• d1aje__ appears in the current release, SCOPe 2.08, called d1ajea1