SCOPe 2.07: Domain d1ajea_: 1aje A:

Lineage for d1ajea_ (1aje A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 protein domains)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (30 PDB entries)

8. Domain d1ajea_: 1aje A: [32071]

Details for d1ajea_

PDB Entry: 1aje

PDB Description: cdc42 from human, nmr, 20 structures

PDB Compounds: (A:) cdc42hs

SCOPe Domain Sequences for d1ajea_:

Sequence; same for both SEQRES and ATOM records:

>d1ajea_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
gskiisamqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytl
glfdtagqedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllv
gtqidlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeai
laaleppepkksrr

Timeline for d1ajea_:

• d1ajea_ first appeared (with stable ids) in SCOP 1.55, called d1aje__
  
• d1ajea_ appears in SCOPe 2.06