SCOPe 2.08: Domain d1ajea1: 1aje A:1-187

Lineage for d1ajea1 (1aje A:1-187)

1. Root: SCOPe 2.08
2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies
5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
6. Protein CDC42 [52619] (2 species)
7. Species Human (Homo sapiens) [TaxId:9606] [52620] (34 PDB entries)
8. Domain d1ajea1: 1aje A:1-187 [32071]
   Other proteins in same PDB: d1ajea2

Details for d1ajea1

PDB Entry: 1aje

PDB Description: cdc42 from human, nmr, 20 structures

PDB Compounds: (A:) cdc42hs

SCOPe Domain Sequences for d1ajea1:

Sequence; same for both SEQRES and ATOM records:

>d1ajea1 c.37.1.8 (A:1-187) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkksrr

SCOPe Domain Coordinates for d1ajea1 are not available.

Timeline for d1ajea1:

• d1ajea1 first appeared (with stable ids) in SCOP 1.55, called d1aje__
  
• d1ajea1 was called d1ajea_ in SCOPe 2.07