Lineage for d1ajea1 (1aje A:1-187)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein CDC42 [52619] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [52620] (34 PDB entries)
  8. Domain d1ajea1: 1aje A:1-187 [32071]
    Other proteins in same PDB: d1ajea2

Details for d1ajea1

PDB Entry: 1aje (more details)

PDB Description: cdc42 from human, nmr, 20 structures
PDB Compounds: (A:) cdc42hs

SCOPe Domain Sequences for d1ajea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ajea1 c.37.1.8 (A:1-187) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkksrr

SCOPe Domain Coordinates for d1ajea1 are not available.

Timeline for d1ajea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ajea2