SCOPe 2.05: Domain d1am4f_: 1am4 F:

Lineage for d1am4f_ (1am4 F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (28 PDB entries)

8. Domain d1am4f_: 1am4 F: [32070]
   Other proteins in same PDB: d1am4a_, d1am4b_, d1am4c_
   complexed with gnp, mg

Details for d1am4f_

PDB Entry: 1am4, 2.7 Å

PDB Description: complex between cdc42hs.gmppnp and p50 rhogap (h. sapiens)

PDB Compounds: (F:) cdc42hs

SCOPe Domain Sequences for d1am4f_:

Sequence, based on SEQRES records:

>d1am4f_ c.37.1.8 (F:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
pqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal

Sequence, based on observed residues (ATOM records):

>d1am4f_ c.37.1.8 (F:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
pqtikcvvvgdgavgktcllisyttnkfyvptvfdnyavtvmiggepytlglfdtagqed
ydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrddp
stieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal

Timeline for d1am4f_:

• d1am4f_ first appeared (with stable ids) in SCOP 1.55
  
• d1am4f_ appears in SCOPe 2.04
  
• d1am4f_ appears in SCOPe 2.06
  
• d1am4f_ appears in the current release, SCOPe 2.08