Lineage for d1am4f_ (1am4 F:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243198Family c.37.1.8: G proteins [52592] (31 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 243222Protein CDC42 [52619] (1 species)
  7. 243223Species Human (Homo sapiens) [TaxId:9606] [52620] (15 PDB entries)
  8. 243241Domain d1am4f_: 1am4 F: [32070]
    Other proteins in same PDB: d1am4a_, d1am4b_, d1am4c_
    complexed with gnp, mg; mutant

Details for d1am4f_

PDB Entry: 1am4 (more details), 2.7 Å

PDB Description: complex between cdc42hs.gmppnp and p50 rhogap (h. sapiens)

SCOP Domain Sequences for d1am4f_:

Sequence, based on SEQRES records: (download)

>d1am4f_ c.37.1.8 (F:) CDC42 {Human (Homo sapiens)}
pqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal

Sequence, based on observed residues (ATOM records): (download)

>d1am4f_ c.37.1.8 (F:) CDC42 {Human (Homo sapiens)}
pqtikcvvvgdgavgktcllisyttnkfyvptvfdnyavtvmiggepytlglfdtagqed
ydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrddp
stieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal

SCOP Domain Coordinates for d1am4f_:

Click to download the PDB-style file with coordinates for d1am4f_.
(The format of our PDB-style files is described here.)

Timeline for d1am4f_: