SCOPe 2.06: Domain d5p4wa_: 5p4w A:

Lineage for d5p4wa_ (5p4w A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Endothiapepsin [50647] (1 species)

7. Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (507 PDB entries)

8. Domain d5p4wa_: 5p4w A: [320693]
   automated match to d1oewa_

Details for d5p4wa_

PDB Entry: 5p4w, 1.15 Å

PDB Description: automated refinement of diffraction data obtained from an endothiapepsin crystal treated with fragment 221

PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d5p4wa_:

Sequence; same for both SEQRES and ATOM records:

>d5p4wa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

Timeline for d5p4wa_:

• d5p4wa_ is new in SCOPe 2.06-stable
  
• d5p4wa_ appears in SCOPe 2.07
  
• d5p4wa_ appears in the current release, SCOPe 2.08