Lineage for d1am4e_ (1am4 E:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) 
Family c.37.1.8: G proteins [52592] (23 proteins) 
Protein CDC42 [52619] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52620] (11 PDB entries) 
Domain d1am4e_: 1am4 E: [32069]
Other proteins in same PDB: d1am4a_, d1am4b_, d1am4c_
Details for d1am4e_
PDB Entry: 1am4 (more details), 2.7 Å
PDB Description: complex between cdc42hs.gmppnp and p50 rhogap (h. sapiens)
SCOP Domain Sequences for d1am4e_:
Sequence, based on SEQRES records: (download)
>d1am4e_ c.37.1.8 (E:) CDC42 {Human (Homo sapiens)}
pqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal
Sequence, based on observed residues (ATOM records): (download)
>d1am4e_ c.37.1.8 (E:) CDC42 {Human (Homo sapiens)}
pqtikcvvvgdgavgktcllisyttnkfyvptvfdnyavtvmiggepytlglfdtagqed
ydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrddp
stieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal
SCOP Domain Coordinates for d1am4e_:
Click to download the PDB-style file with coordinates for d1am4e_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1am4e_:
- d1am4e_ first appeared (with stable ids) in SCOP 1.55
- d1am4e_ appears in SCOP 1.57
- d1am4e_ appears in SCOP 1.61
- d1am4e_ appears in the current release, SCOPe 2.08
View in 3D
