Lineage for d1am4d_ (1am4 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2474974Protein CDC42 [52619] (2 species)
  7. 2474975Species Human (Homo sapiens) [TaxId:9606] [52620] (33 PDB entries)
  8. 2475012Domain d1am4d_: 1am4 D: [32068]
    Other proteins in same PDB: d1am4a_, d1am4b_, d1am4c_
    complexed with gnp, mg

Details for d1am4d_

PDB Entry: 1am4 (more details), 2.7 Å

PDB Description: complex between cdc42hs.gmppnp and p50 rhogap (h. sapiens)
PDB Compounds: (D:) cdc42hs

SCOPe Domain Sequences for d1am4d_:

Sequence, based on SEQRES records: (download)

>d1am4d_ c.37.1.8 (D:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
pqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal

Sequence, based on observed residues (ATOM records): (download)

>d1am4d_ c.37.1.8 (D:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
pqtikcvvvgdgavgktcllisyttnkfyvptvfdnyavtvmiggepytlglfdtagqed
ydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrddp
stieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal

SCOPe Domain Coordinates for d1am4d_:

Click to download the PDB-style file with coordinates for d1am4d_.
(The format of our PDB-style files is described here.)

Timeline for d1am4d_: