Lineage for d1am4d_ (1am4 D:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121912Family c.37.1.8: G proteins [52592] (23 proteins)
  6. 121927Protein CDC42 [52619] (1 species)
  7. 121928Species Human (Homo sapiens) [TaxId:9606] [52620] (11 PDB entries)
  8. 121936Domain d1am4d_: 1am4 D: [32068]
    Other proteins in same PDB: d1am4a_, d1am4b_, d1am4c_

Details for d1am4d_

PDB Entry: 1am4 (more details), 2.7 Å

PDB Description: complex between cdc42hs.gmppnp and p50 rhogap (h. sapiens)

SCOP Domain Sequences for d1am4d_:

Sequence, based on SEQRES records: (download)

>d1am4d_ c.37.1.8 (D:) CDC42 {Human (Homo sapiens)}
pqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal

Sequence, based on observed residues (ATOM records): (download)

>d1am4d_ c.37.1.8 (D:) CDC42 {Human (Homo sapiens)}
pqtikcvvvgdgavgktcllisyttnkfyvptvfdnyavtvmiggepytlglfdtagqed
ydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlrddp
stieklaknkqkpitpetaeklardlkavkyvecsaltqrglknvfdeailaal

SCOP Domain Coordinates for d1am4d_:

Click to download the PDB-style file with coordinates for d1am4d_.
(The format of our PDB-style files is described here.)

Timeline for d1am4d_: