SCOPe 2.08: Domain d5lghl2: 5lgh L:108-213

Lineage for d5lghl2 (5lgh L:108-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5lghl2: 5lgh L:108-213 [320666]
   Other proteins in same PDB: d5lghh_, d5lghl1
   automated match to d1tqbc2
   complexed with 1pe, nag, peg, pg4

Details for d5lghl2

PDB Entry: 5lgh, 1.86 Å

PDB Description: afamin antibody fragment, n14 fab, l1- glycosilated, crystal form ii, same as 5l7x, but isomorphous setting indexed same as 5l88, 5l9d

PDB Compounds: (L:) Mouse Antibody Fab Fragment, IgG1-kappa Light Chain

SCOPe Domain Sequences for d5lghl2:

Sequence; same for both SEQRES and ATOM records:

>d5lghl2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d5lghl2:

• d5lghl2 first appeared in SCOPe 2.06
  
• d5lghl2 appears in SCOPe 2.07