Lineage for d1an0a_ (1an0 A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) 
Family c.37.1.8: G proteins [52592] (23 proteins) 
Protein CDC42 [52619] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52620] (11 PDB entries) 
Domain d1an0a_: 1an0 A: [32066]
Details for d1an0a_
PDB Entry: 1an0 (more details), 2.8 Å
PDB Description: cdc42hs-gdp complex
SCOP Domain Sequences for d1an0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1an0a_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens)}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkksrrcv
SCOP Domain Coordinates for d1an0a_:
Click to download the PDB-style file with coordinates for d1an0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1an0a_:
- d1an0a_ first appeared (with stable ids) in SCOP 1.55
- d1an0a_ appears in SCOP 1.57
- d1an0a_ appears in SCOP 1.61
- d1an0a_ appears in the current release, SCOPe 2.08
View in 3D
