SCOP 1.75: Domain d1a4ra_: 1a4r A:

Lineage for d1a4ra_ (1a4r A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (19 PDB entries)

8. Domain d1a4ra_: 1a4r A: [32063]

Details for d1a4ra_

PDB Entry: 1a4r, 2.5 Å

PDB Description: g12v mutant of human placental cdc42 gtpase in the gdp form

PDB Compounds: (A:) g25k GTP-binding protein

SCOP Domain Sequences for d1a4ra_:

Sequence; same for both SEQRES and ATOM records:

>d1a4ra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdvavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkksrrcvl

Timeline for d1a4ra_:

• d1a4ra_ first appeared (with stable ids) in SCOP 1.55
  
• d1a4ra_ appears in SCOP 1.73
  
• d1a4ra_ appears in SCOPe 2.01
  
• d1a4ra_ appears in the current release, SCOPe 2.08