Lineage for d5kswb2 (5ksw B:103-262)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442174Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2442175Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2442305Family c.25.1.3: Dihydroorotate dehydrogenase B, PyrK subunit [52362] (2 protein domains)
    contains 2Fe-2S cluster in the C-terminal extension
  6. 2442311Protein automated matches [320610] (1 species)
    not a true protein
  7. 2442312Species Lactococcus lactis [TaxId:1360] [320611] (2 PDB entries)
  8. 2442313Domain d5kswb2: 5ksw B:103-262 [320612]
    Other proteins in same PDB: d5kswa_, d5kswb1, d5kswc_, d5kswd1
    automated match to d1ep3b2
    complexed with cl, edo, fad, fes, fmn; mutant

Details for d5kswb2

PDB Entry: 5ksw (more details), 2.47 Å

PDB Description: dhodb-i74d mutant
PDB Compounds: (B:) Dihydroorotate dehydrogenase B (NAD(+)), electron transfer subunit

SCOPe Domain Sequences for d5kswb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kswb2 c.25.1.3 (B:103-262) automated matches {Lactococcus lactis [TaxId: 1360]}
pvdevvstdkilivgggigvpplyelakqleekncqmtillgfasekvkilekefaelkn
vslkiatddgsygtkghvgmlmeeidfevdalytcgapamlkavakkyeqlerlyismes
rmacgigacyacvehdkedenhalkvcedgpvflgkqlll

SCOPe Domain Coordinates for d5kswb2:

Click to download the PDB-style file with coordinates for d5kswb2.
(The format of our PDB-style files is described here.)

Timeline for d5kswb2: