Lineage for d5im0b1 (5im0 B:77-156)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2558726Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2559203Protein automated matches [190332] (5 species)
    not a true protein
  7. 2559214Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)
  8. 2559240Domain d5im0b1: 5im0 B:77-156 [320575]
    Other proteins in same PDB: d5im0b2, d5im0b3
    automated match to d3s7ra_

Details for d5im0b1

PDB Entry: 5im0 (more details), 1.7 Å

PDB Description: crystal structure of the rna recognition motif of mrna decay regulator auf1
PDB Compounds: (B:) heterogeneous nuclear ribonucleoprotein D0

SCOPe Domain Sequences for d5im0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5im0b1 d.58.7.1 (B:77-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egkmfigglswdttkkdlkdyfskfgevvdctlkldpitgrsrgfgfvlfkesesvdkvm
dqkehklngkvidpkrakam

SCOPe Domain Coordinates for d5im0b1:

Click to download the PDB-style file with coordinates for d5im0b1.
(The format of our PDB-style files is described here.)

Timeline for d5im0b1:

View in 3D
Domains from other chains:
(mouse over for more information)
d5im0a_