SCOPe 2.06: Domain d5im0b1: 5im0 B:77-156

Lineage for d5im0b1 (5im0 B:77-156)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)

8. Domain d5im0b1: 5im0 B:77-156 [320575]
   Other proteins in same PDB: d5im0b2, d5im0b3
   automated match to d3s7ra_

Details for d5im0b1

PDB Entry: 5im0, 1.7 Å

PDB Description: crystal structure of the rna recognition motif of mrna decay regulator auf1

PDB Compounds: (B:) heterogeneous nuclear ribonucleoprotein D0

SCOPe Domain Sequences for d5im0b1:

Sequence; same for both SEQRES and ATOM records:

>d5im0b1 d.58.7.1 (B:77-156) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egkmfigglswdttkkdlkdyfskfgevvdctlkldpitgrsrgfgfvlfkesesvdkvm
dqkehklngkvidpkrakam

Timeline for d5im0b1:

• d5im0b1 is new in SCOPe 2.06-stable
  
• d5im0b1 appears in SCOPe 2.07
  
• d5im0b1 appears in the current release, SCOPe 2.08