Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein automated matches [190228] (20 species) not a true protein |
Species Lactococcus lactis [TaxId:1358] [186992] (3 PDB entries) |
Domain d5kswa_: 5ksw A: [320573] Other proteins in same PDB: d5kswb1, d5kswb2, d5kswd1, d5kswd2 automated match to d1ep3a_ complexed with cl, edo, fad, fes, fmn; mutant |
PDB Entry: 5ksw (more details), 2.47 Å
SCOPe Domain Sequences for d5kswa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kswa_ c.1.4.1 (A:) automated matches {Lactococcus lactis [TaxId: 1358]} nrlsvklpgldlknpiipasgcfgfgeeyakyydlnklgsimvkattlhprfgnptprva etasgmlnadglqnpglevimaeklpwlnenfpdlpiianvagseeddyvavcakigdap nvkvielniscpnvkhggqafgtdpdvaaalvkackavskvplyvklspnvtdivpiaka veaagadgltmintlmgvrfdlktrkpvlanitgglsgpaikpvalklihqvaqvvdipi igmggvesaqdvlemymagasavavgtanfadpfvcpkiieklpevmdqygidslenliq evknsk
Timeline for d5kswa_: