SCOP 1.65: Domain d1rrf__: 1rrf -

Lineage for d1rrf__ (1rrf -)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (35 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein ADP-ribosylation factor [52614] (7 species)

7. Species Rat (Rattus norvegicus), ARF1 [TaxId:10116] [52616] (2 PDB entries)

8. Domain d1rrf__: 1rrf - [32056]
   complexed with gdp, mg

Details for d1rrf__

PDB Entry: 1rrf, 3 Å

PDB Description: non-myristoylated rat adp-ribosylation factor-1 complexed with gdp, monomeric crystal form

SCOP Domain Sequences for d1rrf__:

Sequence, based on SEQRES records:

>d1rrf__ c.37.1.8 (-) ADP-ribosylation factor {Rat (Rattus norvegicus), ARF1}
gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl
lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlr

Sequence, based on observed residues (ATOM records):

>d1rrf__ c.37.1.8 (-) ADP-ribosylation factor {Rat (Rattus norvegicus), ARF1}
gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
sftvwdvggqdkirplwrfqntqglifvvdsndrervneareelmrmlaedelrdavllv
fankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlr

Timeline for d1rrf__:

• d1rrf__ first appeared (with stable ids) in SCOP 1.55
  
• d1rrf__ appears in SCOP 1.63
  
• d1rrf__ appears in SCOP 1.67
  
• d1rrf__ appears in the current release, SCOPe 2.08, called d1rrfa_