Lineage for d1rrga_ (1rrg A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110100Protein ADP-ribosylation factor [52614] (16 species)
  7. 2110181Species Norway rat (Rattus norvegicus), ARF1 [TaxId:10116] [52616] (2 PDB entries)
  8. 2110182Domain d1rrga_: 1rrg A: [32054]
    complexed with gdp, mg

Details for d1rrga_

PDB Entry: 1rrg (more details), 2.4 Å

PDB Description: non-myristoylated rat adp-ribosylation factor-1 complexed with gdp, dimeric crystal form
PDB Compounds: (A:) rat ADP-ribosylation factor-1

SCOPe Domain Sequences for d1rrga_:

Sequence, based on SEQRES records: (download)

>d1rrga_ c.37.1.8 (A:) ADP-ribosylation factor {Norway rat (Rattus norvegicus), ARF1 [TaxId: 10116]}
gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
sftvwdvggqdkirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavl
lvfankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk

Sequence, based on observed residues (ATOM records): (download)

>d1rrga_ c.37.1.8 (A:) ADP-ribosylation factor {Norway rat (Rattus norvegicus), ARF1 [TaxId: 10116]}
gnifanlfkglfgkkemrilmvgldaagkttilyklklgeivttiptigfnvetveykni
sftvwdvggirplwrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvf
ankqdlpnamnaaeitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrnqk

SCOPe Domain Coordinates for d1rrga_:

Click to download the PDB-style file with coordinates for d1rrga_.
(The format of our PDB-style files is described here.)

Timeline for d1rrga_: