Class b: All beta proteins [48724] (177 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.2: Pepsin-like [50646] (11 proteins) duplication: consists of two similar barrel domains N-terminal: barrel, partly opened; n*=6, S*=10 |
Protein Endothiapepsin [50647] (1 species) |
Species Chestnut blight fungus (Endothia parasitica) [TaxId:5116] [50648] (507 PDB entries) |
Domain d5oz2a_: 5oz2 A: [320510] automated match to d1oewa_ |
PDB Entry: 5oz2 (more details), 1.61 Å
SCOPe Domain Sequences for d5oz2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5oz2a_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi ginifgdvalkaafvvfngattptlgfask
Timeline for d5oz2a_: